PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG753600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YB
Protein Properties Length: 166aa    MW: 17544.4 Da    PI: 6.5098
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG753600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB174.21.4e-5420115297
                NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                          +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa++ lGf+dyv+p++ +l+kyr
  Pavir.5KG753600.1.p  20 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWAFGALGFDDYVDPMRRHLHKYR 109
                          89**************************************************************************************** PP

                NF-YB  92 elegek 97 
                          eleg++
  Pavir.5KG753600.1.p 110 ELEGDR 115
                          ****97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.9E-5016123IPR009072Histone-fold
SuperFamilySSF471132.02E-3822124IPR009072Histone-fold
PfamPF008084.6E-272588IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.4E-175371No hitNo description
PROSITE patternPS0068505672IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.4E-177290No hitNo description
PRINTSPR006153.4E-1791109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MAADHHGQQP PGAGAEAEIK EQDRLLPIAN VGRIMKQILP PNAKISKEAK ETMQECVSEF  60
ISFVTGEASD KCHKEKRKTV NGDDVCWAFG ALGFDDYVDP MRRHLHKYRE LEGDRAAAAA  120
SSRGGGGSTS AGPDAGAAGP STGHFMFGAA VDRSDNNNSS ASRPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B3e-4319110192Transcription factor HapC (Eurofung)
4g91_B3e-4319110192Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.315160.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9701981e-145EU970198.1 Zea mays clone 342117 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635864.14e-75PREDICTED: nuclear transcription factor Y subunit B-1
RefseqXP_015635872.14e-75PREDICTED: nuclear transcription factor Y subunit B-1
SwissprotO822481e-57NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A0E0JTD01e-76A0A0E0JTD0_ORYPU; Uncharacterized protein
STRINGBGIOSGA000169-PA1e-75(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29173887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.15e-56nuclear factor Y, subunit B5